PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc12g017400.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 320aa    MW: 36600.1 Da    PI: 7.7159
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc12g017400.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.43.4e-54111401128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                         +ppGfrFhPtdeel+ +yL+kkv+ + ++l +vi+evd++k+ePwdL++  ++ +  ++ewyfFs++dkky+tg+r+nrat++g+Wkatg+
  Solyc12g017400.1.1  11 VPPGFRFHPTDEELLYYYLRKKVSYEAIDL-DVIREVDLNKLEPWDLKEicRIGSgPQNEWYFFSHKDKKYPTGTRTNRATTAGFWKATGR 100
                         69****************************.9***************954555442556******************************** PP

                 NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         dk+++ ++++ +g++ktLvfy+grap+g+ktdW+mheyrl
  Solyc12g017400.1.1 101 DKAIYLSNSKRIGMRKTLVFYTGRAPHGQKTDWIMHEYRL 140
                         **************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.07E-597160IPR003441NAC domain
PROSITE profilePS5100558.23411160IPR003441NAC domain
PfamPF023653.9E-2812140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003002Biological Processregionalization
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0010455Biological Processpositive regulation of cell fate commitment
GO:0048829Biological Processroot cap development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MSGSTNGHLS VPPGFRFHPT DEELLYYYLR KKVSYEAIDL DVIREVDLNK LEPWDLKEIC  60
RIGSGPQNEW YFFSHKDKKY PTGTRTNRAT TAGFWKATGR DKAIYLSNSK RIGMRKTLVF  120
YTGRAPHGQK TDWIMHEYRL DDNNAEVEEE GWVVCRVFKK KNYARGFQHD IGEQDHEPQL  180
SFTDPMKGGT SKQNIQQQLQ TASSCYDNYQ SSFDGSMHLP QLLSPDLTLP CPSLVPPPLS  240
NHNLLRLTST SAPNFNFPQQ HDKFSGDWSF LDKLLASSNQ AVVIQSQALT TDLVNPTNSQ  300
KYPIFNHHAF DHDIMKFSK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-50816514170NO APICAL MERISTEM PROTEIN
1ut4_B4e-50816514170NO APICAL MERISTEM PROTEIN
1ut7_A4e-50816514170NO APICAL MERISTEM PROTEIN
1ut7_B4e-50816514170NO APICAL MERISTEM PROTEIN
3swm_A4e-50816517173NAC domain-containing protein 19
3swm_B4e-50816517173NAC domain-containing protein 19
3swm_C4e-50816517173NAC domain-containing protein 19
3swm_D4e-50816517173NAC domain-containing protein 19
3swp_A4e-50816517173NAC domain-containing protein 19
3swp_B4e-50816517173NAC domain-containing protein 19
3swp_C4e-50816517173NAC domain-containing protein 19
3swp_D4e-50816517173NAC domain-containing protein 19
4dul_A4e-50816514170NAC domain-containing protein 19
4dul_B4e-50816514170NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00250DAPTransfer from AT1G79580Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2384701e-07Solanum lycopersicum chromosome 3 clone C03HBa0298P15, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004252144.10.0PREDICTED: NAC domain-containing protein 76 isoform X2
SwissprotQ9MA171e-113SMB_ARATH; Protein SOMBRERO
TrEMBLK4DD730.0K4DD73_SOLLC; Uncharacterized protein
STRINGSolyc12g017400.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13424297
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79580.31e-104NAC family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]